COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays

COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays
SARS-CoV-2 outbreak in China in December 2019 and its unfold as worldwide pandemic has been a significant international well being disaster. Extremely excessive an infection and mortality charge has severely affected all sectors of life and derailed the international financial system. While drug and vaccine improvement have been prioritized and have made vital development, use of phytochemicals and natural constituents is deemed as a low-cost, safer and available different.
We investigated therapeutic efficacy of eight withanolides (derived from Ashwagandha) in opposition to the angiotensin-converting enzyme 2 (ACE2) proteins, a goal cell surface receptor for SARS-CoV-2 and report outcomes on the (i) computational analyses together with binding affinity and secure interactions with ACE2, occupancy of ACE2 residues in making polar and nonpolar interactions with totally different withanolides/ligands and (2) in vitro mRNA and protein analyses utilizing human most cancers (A549, MCF7 and HSC3) cells.
We discovered that amongst all withanolides, Withaferin-A, Withanone, Withanoside-IV and Withanoside-V considerably inhibited the ACE2 expression. Analysis of withanolides-rich aqueous extracts derived from Ashwagandha leaves and stem confirmed a better ACE2 inhibitory efficiency of stem-derived extracts. Taken collectively, we demonstrated the inhibitory efficiency of Ashwagandha withanolides and its aqueous extracts in opposition to ACE2.Communicated by Ramaswamy H. Sarma.

Spectrochemical and biochemical assay comparability research of the therapeutic impact of the Aloe vera and Hypericum perforatum loaded nanofiber dressings on diabetic wound

Diabetic wounds have a gradual therapeutic course of and straightforward to be contaminated. In addition to present drug remedies, supportive approaches are wanted for diabetic wound remedy. In this research, we aimed to load Aloe Vera (AV) and Hypericum perforatum oil (HPO) with PCL/Ge (Poly (ɛ-caprolactone)/Gelatine) polymeric biodegradable by electrospinning methodology into nanofiber dressings on an experimental diabetic wound mannequin to check the diabetic wound therapeutic impact. Changes in the quantity and chemical construction of phospholipids,
proteins, and lipids had been investigated in the blood and serum samples of the animals utilizing Fourier rework infrared (FTIR) evaluation.
COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays
To consider organic occasions related to the wound restore course of in inflammatory section we used oxidant and antioxidant standing to find out the therapeutic standing of wounds akin to Total antioxidant standing (TAS), Total oxidant stage (TOS) and tumor necrosis issue alpha (TNF-α) ranges. TOS stage elevated in DM teams and decreased in the AV and HPO group. Oxidative stress index decreased and TNF-α stage elevated in the HPO group.
FTIR spectra confirmed adjustments in the phospholipids, proteins, and carbon chain of lipids in the entire blood in addition to serum of DM rats. FTIR spectra mixed with Principal part evaluation (PCA) confirmed, that handled DM rats by AV and HPO induced return chemical construction of blood and serum to this noticed in management group. Higher similarity with management group for HPO rats was noticed. HPO is best than AV in the different for therapeutic on diabetic wound. Thus, now we have demonstrated that IR spectroscopy and multivariate information evaluation and biochemical assays are constant and correlative with one another.

Kinetic evaluation of the inhibition mechanism of bovine mitochondrial F1-ATPase inhibitory protein utilizing biochemical assay

ATPase inhibitory issue 1 (IF1) is a mitochondrial regulatory protein that blocks ATP hydrolysis of F1-ATPase, by inserting its N-terminus into the rotor-stator interface of F1-ATPase. Although earlier research have proposed a two-step mannequin for IF1-mediated inhibition, the underlying molecular mechanism stays unclear. Here, we analyzed the kinetics of IF1-mediated inhibition underneath a variety of [ATP]s and [IF1]s, utilizing bovine mitochondrial IF1 and F1-ATPase.
Typical hyperbolic curves of inhibition charges with [IF1]s had been noticed in any respect [ATP]s examined, suggesting a two-step mechanism: the preliminary affiliation of IF1 to F1-ATPase and the locking course of, the place IF1 blocks rotation by inserting its N-terminus. The preliminary affiliation was depending on ATP.
Considering two principal rotation dwells, binding dwell and catalytic dwell, in F1-ATPase, this outcome implies that IF1 associates with F1-ATPase in the catalytic-waiting state. In distinction, the isomerization course of to the locking state was nearly impartial of ATP, suggesting that it is usually impartial of the F1-ATPase state. Further, we investigated the position of Glu30 or Tyr33 of IF1 in the two-step mechanism.
Kinetic evaluation confirmed that Glu30 is concerned in the isomerization, whereas Tyr33 contributes to the preliminary affiliation. Based on the current findings, we suggest an IF1-mediated inhibition scheme.

Further analyses of APRIL/APRIL-Receptor/Glycosaminoglycan interactions by biochemical assays linked to computational research

A proliferation-inducing ligand (APRIL) is a member of the tumor necrosis issue superfamily. APRIL is kind of distinctive on this superfamily for at the least for 2 causes: i) it binds to glycosaminoglycans (GAGs) by way of its positively charged N-terminus; ii) one of its signaling receptor, the transmembrane activator CAML interactor (TACI) was additionally reported to bind GAGs. Here, as offered by biochemical evidences with the use of an APRIL deletion mutant linked to computational research, APRIL-GAG interplay concerned different areas than the APRIL N-terminus.
Preferential interplay of APRIL with heparin adopted by chondroitin sulfate E had been confirmed by in silico evaluation. Both computational and experimental approaches didn’t reveal heparan sulfate binding to TACI.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

PACAP 1-38

B6625-1 1 mg
EUR 347

beta Amyloid P Component (27 38), amide Peptide

20-abx266397
  • EUR 523.00
  • EUR 871.00
  • EUR 384.00
  • 10 mg
  • 25 mg
  • 5 mg

CORNING® REUSABLE PHENOLIC GPI 38-400 THREADED SCREW CAP WITH RUBBER LINER

9999-38 36/pk
EUR 222
Description: General Apparatus; Stoppers

Amyloid b-Protein (36-38)

H-5270.0001 1.0g
EUR 151
Description: Sum Formula: C9H17N3O4; CAS# [21835-35-8]

Amyloid b-Protein (36-38)

H-5270.0005 5.0g
EUR 513
Description: Sum Formula: C9H17N3O4; CAS# [21835-35-8]

Amyloid Beta-peptide (25-35) (human)

A1039-1 1 mg
EUR 115
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-Peptide (12-28) (human)

A1123-1 1 mg
EUR 131
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Human beta-Amyloid 25-35 fragment

BAM2535-1 1 mg
EUR 408

Mouse beta-42(Amyloid Beta 1-42) ELISA Kit

STJ150004 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in Mouse serum, plasma and other biological fluids

Rat beta-40(Amyloid Beta 1-40) ELISA Kit

STJ150091 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Rat beta-42(Amyloid Beta 1-42) ELISA Kit

STJ150196 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in Rat serum, plasma and other biological fluids

Human Beta Amyloid ELISA Kit

QY-E05730 96T
EUR 361

beta-Amyloid (1-11)

5-00416 4 x 5mg Ask for price

beta-Amyloid (1-15)

5-00418 4 x 5mg Ask for price

beta- Amyloid (1-16)

5-00419 4 x 1mg Ask for price

beta-Amyloid (1-28)

5-00421 4 x 1mg Ask for price

beta- Amyloid (1-33)

5-00422 4 x 1mg Ask for price

beta- Amyloid (1-34)

5-00423 4 x 1mg Ask for price

beta- Amyloid (1-37)

5-00424 4 x 1mg Ask for price

beta-Amyloid (1-39)

5-00426 4 x 1mg Ask for price

beta-Amyloid (1-49)

5-00430 4 x 1mg Ask for price

beta-Amyloid(40-1)

5-00456 4 x 1mg Ask for price

Beta Amyloid 1-42

AG138 1 mg
EUR 523

Beta-Amyloid (1-11)

A1002-10 10 mg
EUR 311
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

Beta-Amyloid (1-11)

A1002-25 25 mg
EUR 415
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

Beta-Amyloid (1-11)

A1002-5 5 mg
EUR 206
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

TB (Mycobacterium Tuberculosis Antibody IgG) ELISA test

38 96T/Box Ask for price
Description: ELISA based test for quantitative detection of TB (Mycobacterium Tuberculosis Antibody IgG)

Beta Amyloid

MO20004 100 ug
EUR 246

Beta Amyloid

MO22142 100 ul
EUR 435

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 96 Well Plate
EUR 477

Mouse Beta- defensin 38, Defb38 ELISA KIT

ELI-31016m 96 Tests
EUR 865

FL-411

HY-111102 25mg
EUR 1313

Amyloid P Component (33-38) amide

5-00671 4 x 5mg Ask for price

Amyloid P Component (27-38) amide

H-2942.0001 1.0mg
EUR 113
Description: Sum Formula: C68H107N19O17S; CAS# [180387-75-1] net

Amyloid P Component (27-38) amide

H-2942.0005 5.0mg
EUR 248
Description: Sum Formula: C68H107N19O17S; CAS# [180387-75-1] net

Amyloid P Component (33-38) amide

H-2946.0005 5.0mg
EUR 290
Description: Sum Formula: C37H56N10O7S; CAS# [180387-76-2] net

Amyloid P Component (33-38) amide

H-2946.0025 25.0mg
EUR 1067
Description: Sum Formula: C37H56N10O7S; CAS# [180387-76-2] net

Amyloid ?-Protein (1-15)

A1003-1 1 mg
EUR 113
Description: Beta-amyloid protein (A beta), a 39-43 amino acid peptide composed of a portion of the transmembrane domain and the extracellular domain of the amyloid precursor protein (APP), is also the principal component of amyloid.

PACAP 6-38

B7325-1 1 mg
EUR 290

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Human beta-42(Amyloid Beta Peptide 1-42) ELISA Kit

STJ150128 1 kit
EUR 412
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in human serum, plasma and other biological fluids

Equine amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864ELA-Eq 96 Tests
EUR 928

Human amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864h 96 Tests
EUR 824

Monkey amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Mo 96 Tests
EUR 928

Rabbit amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Rb 96 Tests
EUR 928

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Amyloid Beta 42 (Human) ELISA Kit

E4288-100
EUR 805

[Gln11] -beta- Amyloid (1 - 16)

5-00185 4 x 5mg Ask for price

[Gln11] -beta- Amyloid (1 - 28)

5-00186 4 x 1mg Ask for price

[Gln11] -beta- Amyloid (1 - 40)

5-00187 4 x 1mg Ask for price

[Gln22] -beta- Amyloid (1 - 40)

5-00190 4 x 1mg Ask for price

[Gly22] -beta- Amyloid (1 - 40)

5-00201 4 x 1mg Ask for price

[Val35] -beta - Amyloid (1 - 42)

5-00369 4 x 1mg Ask for price

beta-Amyloid (1-40), rat

5-00427 4 x 1mg Ask for price

beta-Amyloid (1-42), human

5-00429 4 x 1mg Ask for price

Amyloid beta-Protein (1-43)

5-00662 4 x 1mg Ask for price

Amyloid beta-Protein (42-1)

5-00667 4 x 1mg Ask for price

Cys-beta- Amyloid (1 - 40)

5-01014 4 x 1mg Ask for price

Anti-beta Amyloid 1-42

AT138 1mg
EUR 1114

beta Amyloid (1-11) Peptide

20-abx266241
  • EUR 467.00
  • EUR 759.00
  • EUR 342.00
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (1-15) Peptide

20-abx266490
  • EUR 578.00
  • EUR 996.00
  • EUR 411.00
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (1-14) Peptide

20-abx265397
  • EUR 551.00
  • EUR 926.00
  • EUR 398.00
  • 10 mg
  • 25 mg
  • 5 mg

Amyloid beta 1-42 Protein

abx060277-100ug 100 ug
EUR 759

Amyloid beta (1-40) Antibody

abx020617-100ug 100 ug
EUR 982

Amyloid beta (1-42) Antibody

abx020619-100ug 100 ug
EUR 982

PACAP (1-38), Human, Ovine, Rat

SP-52290-1 0.5 mg
EUR 351

BDP FL alkyne, 1 mg

A14B0 1 mg
EUR 108

BDP FL DBCO, 1 mg

A14F0 1 mg
EUR 108

BDP FL azide, 1 mg

11430 1 mg
EUR 108

BDP FL hydrazide, 1 mg

11470 1 mg
EUR 108

BDP FL maleimide, 1 mg

11480 1 mg
EUR 108

BDP FL amine, 1 mg

114C0 1 mg
EUR 108

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 96 Well Plate
EUR 477

Tyr-Amyloid P Component (27-38) amide

5-02031 4 x 5mg Ask for price

Amyloid P Component (33-38) amide Peptide

20-abx265867
  • EUR 356.00
  • EUR 537.00
  • EUR 286.00
  • 10 mg
  • 25 mg
  • 5 mg

Tyr-Amyloid P Component (27-38) amide

H-2944.0001 1.0mg
EUR 113
Description: Sum Formula: C77H116N20O19S; CAS# [198268-71-2] net

Tyr-Amyloid P Component (27-38) amide

H-2944.0005 5.0mg
EUR 249
Description: Sum Formula: C77H116N20O19S; CAS# [198268-71-2] net

beta Amyloid antibody

70R-AR020 100 ug
EUR 300
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

beta Amyloid antibody

70R-BR019 100 ug
EUR 300
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

Beta Amyloid antibody

70R-51450 100 ul
EUR 287
Description: Purified Polyclonal Beta Amyloid antibody

beta Amyloid protein

30R-3244 50 ug
EUR 257
Description: Purified recombinant beta Amyloid protein

beta Amyloid antibody

20R-AR011 250 ul
EUR 381
Description: Rabbit polyclonal beta Amyloid antibody

beta Amyloid antibody

70R-10624 1 ml
EUR 693
Description: Affinity purified Chicken polyclonal beta Amyloid antibody

beta Amyloid antibody

70R-12571 100 ul
EUR 457
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

beta Amyloid antibody

10R-7917 100 ug
EUR 322
Description: Mouse monoclonal beta Amyloid antibody

beta Amyloid antibody

10R-A124a 50 ug
EUR 1011
Description: Mouse monoclonal beta Amyloid antibody

beta-Amyloid antibody

22965-100ul 100ul
EUR 390

beta Amyloid Antibody

35506-100ul 100ul
EUR 390

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-192T 192 tests
EUR 1270
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-48 1 plate of 48 wells
EUR 520
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-96 1 plate of 96 wells
EUR 685
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

20-abx258778
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Human Interleukin 38(IL-38) ELISA Kit

QY-E05451 96T
EUR 361

GFP (FL) Antibody

48297-100ul 100ul
EUR 333

GFP (FL) Antibody

48297-50ul 50ul
EUR 239

Mouse Beta- amyloid protein 42, Beta- APP42 ELISA KIT

ELI-03782m 96 Tests
EUR 865

Human Beta- amyloid protein 42, Beta- APP42 ELISA KIT

ELI-03783h 96 Tests
EUR 824

Mouse Beta-APP42/ Beta-amyloid protein 42 ELISA Kit

E0175Mo 1 Kit
EUR 571

Human Beta-APP42/ Beta-amyloid protein 42 ELISA Kit

E0270Hu 1 Kit
EUR 571

Beta-APP42 ELISA Kit| Mouse Beta-amyloid protein 42 ELISA Kit

EF013161 96 Tests
EUR 689

Human Beta amyloid precursor protein ELISA Kit

ELA-E1020h 96 Tests
EUR 824

Human amyloid beta A4 protein ELISA Kit

CSB-E14352h-24T 1 plate of 24 wells
EUR 165
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta A4 protein in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta A4 protein ELISA Kit

1-CSB-E14352h
  • EUR 703.00
  • EUR 4843.00
  • EUR 2570.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta A4 protein in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Aβ40(Amyloid Beta 40) ELISA Kit

EM0863 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 46.875pg/ml

Mouse Aβ42(Amyloid Beta 42) ELISA Kit

EM0864 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 2.344pg/ml

Human Aβ40(Amyloid Beta 40) ELISA Kit

EH2684 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Aβ42(Amyloid Beta 42) ELISA Kit

EH2685 96T
EUR 524.1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 2.813pg/ml

Rat Aβ40(Amyloid Beta 40) ELISA Kit

ER0754 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 46.875pg/ml

Rat Aβ42(Amyloid Beta 42) ELISA Kit

ER0755 96T
EUR 476.25
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 9.375pg/ml

Amyloid Stain Kit (Congo Red)

AMY-1 1 kit(s)
EUR 165

Human Amyloid Precursor Protein (APP) AssayMax ELISA Kit

EA5801-1 96 Well Plate
EUR 477

Human Serum Amyloid A (SAA) AssayMax ELISA Kit

EA8001-1 96 Well Plate
EUR 417

Anti-beta Amyloid 1-42 (2C12)

YF-MA11960 100 ug
EUR 363
Description: Mouse monoclonal to beta Amyloid 1-42

Anti-beta Amyloid 1-42 (1E6)

YF-MA11961 100 ug
EUR 363
Description: Mouse monoclonal to beta Amyloid 1-42

[Arg3]-Amyloid beta-Protein (1-40)

5-00039 4 x 1mg Ask for price

[Gln9]-Amyloid beta-Protein (1-40)

5-00194 4 x 1mg Ask for price

beta-Amyloid (1-14) , mouse, rat

5-00417 4 x 5mg Ask for price

beta-Amyloid(1-16), mouse, rat

5-00420 4 x 1mg Ask for price

beta-Amyloid Peptide (1-42), rat

5-00460 4 x 1mg Ask for price

Biotin-Amyloid beta-Protein (1-40)

5-00776 4 x 1mg Ask for price

Biotin-Amyloid beta-Protein (1-42)

5-00777 4 x 1mg Ask for price

[Gln11] beta Amyloid (1-16) Peptide

20-abx266503
  • EUR 592.00
  • EUR 1024.00
  • EUR 425.00
  • 10 mg
  • 25 mg
  • 5 mg

Amyloid beta (1-40 / 42) Antibody

abx020618-100ug 100 ug
EUR 982
Together, computational outcomes corroborated experiments contributing with atomistic particulars to the information on this biologically related trimolecular system. Additionally, a high-throughput rigorous evaluation of the free power calculations information was carried out to critically consider the utilized computational methodologies.

You Might Also Like

Leave a Reply