COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays

COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays
SARS-CoV-2 outbreak in China in December 2019 and its unfold as worldwide pandemic has been a significant international well being disaster. Extremely excessive an infection and mortality charge has severely affected all sectors of life and derailed the international financial system. While drug and vaccine improvement have been prioritized and have made vital development, use of phytochemicals and natural constituents is deemed as a low-cost, safer and available different.
We investigated therapeutic efficacy of eight withanolides (derived from Ashwagandha) in opposition to the angiotensin-converting enzyme 2 (ACE2) proteins, a goal cell surface receptor for SARS-CoV-2 and report outcomes on the (i) computational analyses together with binding affinity and secure interactions with ACE2, occupancy of ACE2 residues in making polar and nonpolar interactions with totally different withanolides/ligands and (2) in vitro mRNA and protein analyses utilizing human most cancers (A549, MCF7 and HSC3) cells.
We discovered that amongst all withanolides, Withaferin-A, Withanone, Withanoside-IV and Withanoside-V considerably inhibited the ACE2 expression. Analysis of withanolides-rich aqueous extracts derived from Ashwagandha leaves and stem confirmed a better ACE2 inhibitory efficiency of stem-derived extracts. Taken collectively, we demonstrated the inhibitory efficiency of Ashwagandha withanolides and its aqueous extracts in opposition to ACE2.Communicated by Ramaswamy H. Sarma.

Spectrochemical and biochemical assay comparability research of the therapeutic impact of the Aloe vera and Hypericum perforatum loaded nanofiber dressings on diabetic wound

Diabetic wounds have a gradual therapeutic course of and straightforward to be contaminated. In addition to present drug remedies, supportive approaches are wanted for diabetic wound remedy. In this research, we aimed to load Aloe Vera (AV) and Hypericum perforatum oil (HPO) with PCL/Ge (Poly (ɛ-caprolactone)/Gelatine) polymeric biodegradable by electrospinning methodology into nanofiber dressings on an experimental diabetic wound mannequin to check the diabetic wound therapeutic impact. Changes in the quantity and chemical construction of phospholipids,
proteins, and lipids had been investigated in the blood and serum samples of the animals utilizing Fourier rework infrared (FTIR) evaluation.
COVID19-inhibitory activity of withanolides involves targeting of the host cell surface receptor ACE2: insights from computational and biochemical assays
To consider organic occasions related to the wound restore course of in inflammatory section we used oxidant and antioxidant standing to find out the therapeutic standing of wounds akin to Total antioxidant standing (TAS), Total oxidant stage (TOS) and tumor necrosis issue alpha (TNF-α) ranges. TOS stage elevated in DM teams and decreased in the AV and HPO group. Oxidative stress index decreased and TNF-α stage elevated in the HPO group.
FTIR spectra confirmed adjustments in the phospholipids, proteins, and carbon chain of lipids in the entire blood in addition to serum of DM rats. FTIR spectra mixed with Principal part evaluation (PCA) confirmed, that handled DM rats by AV and HPO induced return chemical construction of blood and serum to this noticed in management group. Higher similarity with management group for HPO rats was noticed. HPO is best than AV in the different for therapeutic on diabetic wound. Thus, now we have demonstrated that IR spectroscopy and multivariate information evaluation and biochemical assays are constant and correlative with one another.

Kinetic evaluation of the inhibition mechanism of bovine mitochondrial F1-ATPase inhibitory protein utilizing biochemical assay

ATPase inhibitory issue 1 (IF1) is a mitochondrial regulatory protein that blocks ATP hydrolysis of F1-ATPase, by inserting its N-terminus into the rotor-stator interface of F1-ATPase. Although earlier research have proposed a two-step mannequin for IF1-mediated inhibition, the underlying molecular mechanism stays unclear. Here, we analyzed the kinetics of IF1-mediated inhibition underneath a variety of [ATP]s and [IF1]s, utilizing bovine mitochondrial IF1 and F1-ATPase.
Typical hyperbolic curves of inhibition charges with [IF1]s had been noticed in any respect [ATP]s examined, suggesting a two-step mechanism: the preliminary affiliation of IF1 to F1-ATPase and the locking course of, the place IF1 blocks rotation by inserting its N-terminus. The preliminary affiliation was depending on ATP.
Considering two principal rotation dwells, binding dwell and catalytic dwell, in F1-ATPase, this outcome implies that IF1 associates with F1-ATPase in the catalytic-waiting state. In distinction, the isomerization course of to the locking state was nearly impartial of ATP, suggesting that it is usually impartial of the F1-ATPase state. Further, we investigated the position of Glu30 or Tyr33 of IF1 in the two-step mechanism.
Kinetic evaluation confirmed that Glu30 is concerned in the isomerization, whereas Tyr33 contributes to the preliminary affiliation. Based on the current findings, we suggest an IF1-mediated inhibition scheme.

Further analyses of APRIL/APRIL-Receptor/Glycosaminoglycan interactions by biochemical assays linked to computational research

A proliferation-inducing ligand (APRIL) is a member of the tumor necrosis issue superfamily. APRIL is kind of distinctive on this superfamily for at the least for 2 causes: i) it binds to glycosaminoglycans (GAGs) by way of its positively charged N-terminus; ii) one of its signaling receptor, the transmembrane activator CAML interactor (TACI) was additionally reported to bind GAGs. Here, as offered by biochemical evidences with the use of an APRIL deletion mutant linked to computational research, APRIL-GAG interplay concerned different areas than the APRIL N-terminus.
Preferential interplay of APRIL with heparin adopted by chondroitin sulfate E had been confirmed by in silico evaluation. Both computational and experimental approaches didn’t reveal heparan sulfate binding to TACI.

Amyloid b-Protein (1-38)

H-2966.1000 Bachem 1.0mg 267 EUR
Description: Sum Formula: C184H277N51O56S; CAS# [131438-74-9] net

PACAP 1-38

B6625-1 ApexBio 1 mg 347 EUR

beta Amyloid P Component (27 38), amide Peptide

20-abx266397 Abbexa
  • 523.00 EUR
  • 871.00 EUR
  • 384.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

CORNING® REUSABLE PHENOLIC GPI 38-400 THREADED SCREW CAP WITH RUBBER LINER

9999-38 CORNING 36/pk 222 EUR
Description: General Apparatus; Stoppers

Amyloid Beta-peptide (25-35) (human)

A1039-1 ApexBio 1 mg 115 EUR
Description: Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-GlyAmyloid- ? (A?) peptide is commonly found in human Alzheimer?s disease (AD) brain and is the main component of Alzheimer amyloid plaques. The predominant forms of A? in the human brain are A? (1-40) and A? (1-42).

Amyloid Beta-Peptide (12-28) (human)

A1123-1 ApexBio 1 mg 131 EUR
Description: Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Human beta-Amyloid 25-35 fragment

BAM2535-1 Alpha Diagnostics 1 mg 408 EUR

Amyloid b-Protein (36-38)

H-5270.0001 Bachem 1.0g 151 EUR
Description: Sum Formula: C9H17N3O4; CAS# [21835-35-8]

Amyloid b-Protein (36-38)

H-5270.0005 Bachem 5.0g 513 EUR
Description: Sum Formula: C9H17N3O4; CAS# [21835-35-8]

Mouse beta-42(Amyloid Beta 1-42) ELISA Kit

STJ150004 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in Mouse serum, plasma and other biological fluids

Rat beta-40(Amyloid Beta 1-40) ELISA Kit

STJ150091 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Rat serum, plasma and other biological fluids

Rat beta-42(Amyloid Beta 1-42) ELISA Kit

STJ150196 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in Rat serum, plasma and other biological fluids

Human Beta Amyloid ELISA Kit

QY-E05730 Qayee Biotechnology 96T 361 EUR

beta-Amyloid (1-11)

5-00416 CHI Scientific 4 x 5mg Ask for price

beta-Amyloid (1-15)

5-00418 CHI Scientific 4 x 5mg Ask for price

beta- Amyloid (1-16)

5-00419 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-28)

5-00421 CHI Scientific 4 x 1mg Ask for price

beta- Amyloid (1-33)

5-00422 CHI Scientific 4 x 1mg Ask for price

beta- Amyloid (1-34)

5-00423 CHI Scientific 4 x 1mg Ask for price

beta- Amyloid (1-37)

5-00424 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-39)

5-00426 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-49)

5-00430 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid(40-1)

5-00456 CHI Scientific 4 x 1mg Ask for price

Beta Amyloid 1-42

AG138 Unibiotest 1 mg 523 EUR

Beta-Amyloid (1-11)

A1002-10 ApexBio 10 mg 311 EUR
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

Beta-Amyloid (1-11)

A1002-25 ApexBio 25 mg 415 EUR
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

Beta-Amyloid (1-11)

A1002-5 ApexBio 5 mg 206 EUR
Description: Beta-amyloid (1-11) (Abeta or A?) (C56H76N16O22) is a peptide with the sequence H-{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}-OH,which is processed from the Amyloid precursor protein.

TB (Mycobacterium Tuberculosis Antibody IgG) ELISA test

38 Biobase 96T/Box Ask for price
Description: ELISA based test for quantitative detection of TB (Mycobacterium Tuberculosis Antibody IgG)

Beta Amyloid

MO20004 Neuromics 100 ug 246 EUR

Beta Amyloid

MO22142 Neuromics 100 ul 435 EUR

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 AssayPro 96 Well Plate 477 EUR

Mouse Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EMI2200-1 AssayPro 96 Well Plate 477 EUR

Amyloid ?-Protein (1-15)

A1003-1 ApexBio 1 mg 113 EUR
Description: Beta-amyloid protein (A beta), a 39-43 amino acid peptide composed of a portion of the transmembrane domain and the extracellular domain of the amyloid precursor protein (APP), is also the principal component of amyloid.

Mouse beta-40(Amyloid Beta Peptide 1-40)ELISA Kit

STJ150003 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in Mouse serum, plasma and other biological fluids

Human beta-40(Amyloid Beta Peptide 1-40) ELISA Kit

STJ150127 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-40 in human serum, plasma and other biological fluids

Human beta-42(Amyloid Beta Peptide 1-42) ELISA Kit

STJ150128 St John's Laboratory 1 kit 412 EUR
Description: The kit is a sandwich enzyme immunoassay for in vitro quantitative measurement of Abeta1-42 in human serum, plasma and other biological fluids

Mouse Beta- defensin 38, Defb38 ELISA KIT

ELI-31016m Lifescience Market 96 Tests 865 EUR

Amyloid P Component (33-38) amide

5-00671 CHI Scientific 4 x 5mg Ask for price

Amyloid P Component (27-38) amide

H-2942.0001 Bachem 1.0mg 113 EUR
Description: Sum Formula: C68H107N19O17S; CAS# [180387-75-1] net

Amyloid P Component (27-38) amide

H-2942.0005 Bachem 5.0mg 248 EUR
Description: Sum Formula: C68H107N19O17S; CAS# [180387-75-1] net

Amyloid P Component (33-38) amide

H-2946.0005 Bachem 5.0mg 290 EUR
Description: Sum Formula: C37H56N10O7S; CAS# [180387-76-2] net

Amyloid P Component (33-38) amide

H-2946.0025 Bachem 25.0mg 1067 EUR
Description: Sum Formula: C37H56N10O7S; CAS# [180387-76-2] net

PACAP 6-38

B7325-1 ApexBio 1 mg 290 EUR

Equine amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864ELA-Eq Lifescience Market 96 Tests 928 EUR

Human amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864h Lifescience Market 96 Tests 824 EUR

Monkey amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Mo Lifescience Market 96 Tests 928 EUR

Rabbit amyloid beta peptide 1- 40 ELISA Kit

ELA-E0864Rb Lifescience Market 96 Tests 928 EUR

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey amyloid beta peptide 1-40 ELISA kit

E09A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Monkey amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog amyloid beta peptide 1-40 ELISA kit

E08A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Canine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human amyloid beta peptide 1-40 ELISA kit

E01A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Human amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit amyloid beta peptide 1-40 ELISA kit

E04A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Rabbit amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse amyloid beta peptide 1-40 ELISA kit

E03A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Mouse amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat amyloid beta peptide 1-40 ELISA kit

E02A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Rat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig amyloid beta peptide 1-40 ELISA kit

E07A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Porcine amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat amyloid beta peptide 1-40 ELISA kit

E06A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Goat amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Amyloid Beta 42 (Human) ELISA Kit

E4288-100 Biovision 805 EUR

[Gln11] -beta- Amyloid (1 - 16)

5-00185 CHI Scientific 4 x 5mg Ask for price

[Gln11] -beta- Amyloid (1 - 28)

5-00186 CHI Scientific 4 x 1mg Ask for price

[Gln11] -beta- Amyloid (1 - 40)

5-00187 CHI Scientific 4 x 1mg Ask for price

[Gln22] -beta- Amyloid (1 - 40)

5-00190 CHI Scientific 4 x 1mg Ask for price

[Gly22] -beta- Amyloid (1 - 40)

5-00201 CHI Scientific 4 x 1mg Ask for price

[Val35] -beta - Amyloid (1 - 42)

5-00369 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-40), rat

5-00427 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-42), human

5-00429 CHI Scientific 4 x 1mg Ask for price

Amyloid beta-Protein (1-43)

5-00662 CHI Scientific 4 x 1mg Ask for price

Amyloid beta-Protein (42-1)

5-00667 CHI Scientific 4 x 1mg Ask for price

Cys-beta- Amyloid (1 - 40)

5-01014 CHI Scientific 4 x 1mg Ask for price

Anti-beta Amyloid 1-42

AT138 Unibiotest 1mg 1114 EUR

Amyloid beta 1-42 Protein

abx060277-100ug Abbexa 100 ug 759 EUR

Amyloid beta (1-40) Antibody

abx020617-100ug Abbexa 100 ug 982 EUR

Amyloid beta (1-42) Antibody

abx020619-100ug Abbexa 100 ug 982 EUR

beta Amyloid (1-11) Peptide

20-abx266241 Abbexa
  • 467.00 EUR
  • 759.00 EUR
  • 342.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (1-15) Peptide

20-abx266490 Abbexa
  • 578.00 EUR
  • 996.00 EUR
  • 411.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid (1-14) Peptide

20-abx265397 Abbexa
  • 551.00 EUR
  • 926.00 EUR
  • 398.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

beta Amyloid 1-42 Antibody

AF0019 Affbiotech 100ul 350 EUR

Amyloid ?-Peptide (1-42) (human)

B6057-.1 ApexBio 100 ug 276 EUR

PACAP (1-38), Human, Ovine, Rat

SP-52290-1 Alpha Diagnostics 0.5 mg 351 EUR

beta-Amyloid antibody

22965-100ul SAB 100ul 390 EUR

beta Amyloid Antibody

35506-100ul SAB 100ul 390 EUR

beta Amyloid antibody

10R-7917 Fitzgerald 100 ug 322 EUR
Description: Mouse monoclonal beta Amyloid antibody

beta Amyloid antibody

10R-A124a Fitzgerald 50 ug 1011 EUR
Description: Mouse monoclonal beta Amyloid antibody

beta Amyloid antibody

70R-10624 Fitzgerald 1 ml 693 EUR
Description: Affinity purified Chicken polyclonal beta Amyloid antibody

beta Amyloid antibody

20R-AR011 Fitzgerald 250 ul 381 EUR
Description: Rabbit polyclonal beta Amyloid antibody

beta Amyloid antibody

70R-12571 Fitzgerald 100 ul 457 EUR
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

Beta Amyloid antibody

70R-51450 Fitzgerald 100 ul 287 EUR
Description: Purified Polyclonal Beta Amyloid antibody

beta Amyloid antibody

70R-AR020 Fitzgerald 100 ug 300 EUR
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

beta Amyloid antibody

70R-BR019 Fitzgerald 100 ug 300 EUR
Description: Affinity purified Rabbit polyclonal beta Amyloid antibody

beta Amyloid protein

30R-3244 Fitzgerald 50 ug 257 EUR
Description: Purified recombinant beta Amyloid protein

Human TGF-beta-1 AssayMax ELISA Kit

ET3102-1 AssayPro 96 Well Plate 477 EUR

Tyr-Amyloid P Component (27-38) amide

5-02031 CHI Scientific 4 x 5mg Ask for price

Amyloid P Component (33-38) amide Peptide

20-abx265867 Abbexa
  • 356.00 EUR
  • 537.00 EUR
  • 286.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

Tyr-Amyloid P Component (27-38) amide

H-2944.0001 Bachem 1.0mg 113 EUR
Description: Sum Formula: C77H116N20O19S; CAS# [198268-71-2] net

Tyr-Amyloid P Component (27-38) amide

H-2944.0005 Bachem 5.0mg 249 EUR
Description: Sum Formula: C77H116N20O19S; CAS# [198268-71-2] net

Amyloid Beta Peptide 1-42 (Ab1-42) ELISA Kit

20-abx258778 Abbexa
  • 7378.00 EUR
  • 3933.00 EUR
  • 911.00 EUR
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-192T BlueGene 192 tests 1270 EUR
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-48 BlueGene 1 plate of 48 wells 520 EUR
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig amyloid beta peptide 1-40 ELISA kit

E05A0910-96 BlueGene 1 plate of 96 wells 685 EUR
Description: A competitive ELISA for quantitative measurement of Guinea pig amyloid beta peptide 1-40 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Beta-APP42/ Beta-amyloid protein 42 ELISA Kit

E0175Mo Sunlong 1 Kit 571 EUR

Human Beta-APP42/ Beta-amyloid protein 42 ELISA Kit

E0270Hu Sunlong 1 Kit 571 EUR

Mouse Beta- amyloid protein 42, Beta- APP42 ELISA KIT

ELI-03782m Lifescience Market 96 Tests 865 EUR

Human Beta- amyloid protein 42, Beta- APP42 ELISA KIT

ELI-03783h Lifescience Market 96 Tests 824 EUR

FL-411

HY-111102 MedChemExpress 25mg 1313 EUR

Beta-APP42 ELISA Kit| Mouse Beta-amyloid protein 42 ELISA Kit

EF013161 Lifescience Market 96 Tests 689 EUR

Amyloid Stain Kit (Congo Red)

AMY-1 ScyTek Laboratories 1 kit(s) 165 EUR

Human amyloid beta A4 protein ELISA Kit

CSB-E14352h-24T Cusabio 1 plate of 24 wells 165 EUR
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta A4 protein in samples from serum, plasma, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human amyloid beta A4 protein ELISA Kit

1-CSB-E14352h Cusabio
  • 703.00 EUR
  • 4843.00 EUR
  • 2570.00 EUR
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
Description: Quantitativesandwich ELISA kit for measuring Human amyloid beta A4 protein in samples from serum, plasma, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Aβ40(Amyloid Beta 40) ELISA Kit

ER0754 FN Test 96T 476.25 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 46.875pg/ml

Rat Aβ42(Amyloid Beta 42) ELISA Kit

ER0755 FN Test 96T 476.25 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Rattus;Sensitivity: 9.375pg/ml

Human Aβ40(Amyloid Beta 40) ELISA Kit

EH2684 FN Test 96T 524.1 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Aβ42(Amyloid Beta 42) ELISA Kit

EH2685 FN Test 96T 524.1 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 2.813pg/ml

Mouse Aβ40(Amyloid Beta 40) ELISA Kit

EM0863 FN Test 96T 476.25 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 46.875pg/ml

Mouse Aβ42(Amyloid Beta 42) ELISA Kit

EM0864 FN Test 96T 476.25 EUR
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Mus ;Sensitivity: 2.344pg/ml

Human Beta amyloid precursor protein ELISA Kit

ELA-E1020h Lifescience Market 96 Tests 824 EUR

Human Interleukin 38(IL-38) ELISA Kit

QY-E05451 Qayee Biotechnology 96T 361 EUR

Human Amyloid Precursor Protein (APP) AssayMax ELISA Kit

EA5801-1 AssayPro 96 Well Plate 477 EUR

Human Serum Amyloid A (SAA) AssayMax ELISA Kit

EA8001-1 AssayPro 96 Well Plate 417 EUR

Beta-Amyloid(1-14),mouse,rat

HY-P1524 MedChemExpress 5mg 326 EUR

Abeta 40 (beta amyloid 1-40)

RA25009 Neuromics 100 ul 383 EUR

[Arg3]-Amyloid beta-Protein (1-40)

5-00039 CHI Scientific 4 x 1mg Ask for price

[Gln9]-Amyloid beta-Protein (1-40)

5-00194 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid (1-14) , mouse, rat

5-00417 CHI Scientific 4 x 5mg Ask for price

beta-Amyloid(1-16), mouse, rat

5-00420 CHI Scientific 4 x 1mg Ask for price

beta-Amyloid Peptide (1-42), rat

5-00460 CHI Scientific 4 x 1mg Ask for price

Biotin-Amyloid beta-Protein (1-40)

5-00776 CHI Scientific 4 x 1mg Ask for price

Biotin-Amyloid beta-Protein (1-42)

5-00777 CHI Scientific 4 x 1mg Ask for price

Amyloid beta (1-40 / 42) Antibody

abx020618-100ug Abbexa 100 ug 982 EUR

[Gln11] beta Amyloid (1-16) Peptide

20-abx266503 Abbexa
  • 592.00 EUR
  • 1024.00 EUR
  • 425.00 EUR
  • 10 mg
  • 25 mg
  • 5 mg

Amyloid Beta-Peptide (1-40) (human)

A1124-10 ApexBio 10 mg 746 EUR
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-25 ApexBio 25 mg 1024 EUR
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Amyloid Beta-Peptide (1-40) (human)

A1124-5 ApexBio 5 mg 467 EUR
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Anti-beta Amyloid 1-42 (2C12)

YF-MA11960 Abfrontier 100 ug 363 EUR
Description: Mouse monoclonal to beta Amyloid 1-42

Anti-beta Amyloid 1-42 (1E6)

YF-MA11961 Abfrontier 100 ug 363 EUR
Description: Mouse monoclonal to beta Amyloid 1-42

ELISA kit for Rat Amyloid beta (ABeta)  Kit

KTE101129-5platesof96wells Abbkine 5 plates of 96 wells 2252 EUR
Description: Quantitative sandwich ELISA for measuring Rat Amyloid beta (ABeta)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Amyloid beta (ABeta)  Kit

KTE101129-48T Abbkine 48T 354 EUR
Description: Quantitative sandwich ELISA for measuring Rat Amyloid beta (ABeta)  Kit in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.
Together, computational outcomes corroborated experiments contributing with atomistic particulars to the information on this biologically related trimolecular system. Additionally, a high-throughput rigorous evaluation of the free power calculations information was carried out to critically consider the utilized computational methodologies.

You Might Also Like

Leave a Reply